SCOPe 2.01: Domain d1oqnb_: 1oqn B:

Lineage for d1oqnb_ (1oqn B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Disabled homolog 1 (Dab1) [89357] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89358] (3 PDB entries)

8. Domain d1oqnb_: 1oqn B: [93421]
   complexed with peptide and I3P
   complexed with i3p

Details for d1oqnb_

PDB Entry: 1oqn, 2.3 Å

PDB Description: Crystal structure of the phosphotyrosine binding domain (PTB) of mouse Disabled 1 (Dab1)

PDB Compounds: (B:) Disabled homolog 1

SCOPe Domain Sequences for d1oqnb_:

Sequence; same for both SEQRES and ATOM records:

>d1oqnb_ b.55.1.2 (B:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]}
drseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqk
ifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaikta
qaaepvildlrdlfqliyelkqreelekkaq

Timeline for d1oqnb_:

• d1oqnb_ first appeared in SCOP 1.67
  
• d1oqnb_ appears in SCOP 1.75
  
• d1oqnb_ appears in SCOPe 2.02
  
• d1oqnb_ appears in the current release, SCOPe 2.08