SCOP 1.69: Domain d1oqna_: 1oqn A:

Lineage for d1oqna_ (1oqn A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)

6. Protein Disabled homolog 1 (Dab1) [89357] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89358] (3 PDB entries)

8. Domain d1oqna_: 1oqn A: [93420]

Details for d1oqna_

PDB Entry: 1oqn, 2.3 Å

PDB Description: Crystal structure of the phosphotyrosine binding domain (PTB) of mouse Disabled 1 (Dab1)

SCOP Domain Sequences for d1oqna_:

Sequence; same for both SEQRES and ATOM records:

>d1oqna_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus)}
rseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqki
fltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaiktaq
aaepvildlrdlfqliyelkqreelekkaq

Timeline for d1oqna_:

• d1oqna_ first appeared in SCOP 1.67
  
• d1oqna_ appears in SCOP 1.71
  
• d1oqna_ appears in the current release, SCOPe 2.08