Class b: All beta proteins [48724] (141 folds) |
Fold b.137: RNase P subunit p29-like [101743] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
Superfamily b.137.1: RNase P subunit p29-like [101744] (1 family) |
Family b.137.1.1: RNase P subunit p29-like [101745] (2 proteins) two available NMR structures display similar topologies but different barrel shapes |
Protein Hypothetical protein MTH11 [101748] (1 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [101749] (1 PDB entry) |
Domain d1oqka_: 1oqk A: [93419] |
PDB Entry: 1oqk (more details)
SCOP Domain Sequences for d1oqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqka_ b.137.1.1 (A:) Hypothetical protein MTH11 {Archaeon Methanobacterium thermoautotrophicum} rheliglsvriarsvhrdiqgisgrvvdetrntlriemddgreitvpkgiavfhfrtpqg elveidgralvarpeeri
Timeline for d1oqka_: