Lineage for d1oqka_ (1oqk A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383557Fold b.137: RNase P subunit p29-like [101743] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 383558Superfamily b.137.1: RNase P subunit p29-like [101744] (1 family) (S)
  5. 383559Family b.137.1.1: RNase P subunit p29-like [101745] (2 proteins)
    two available NMR structures display similar topologies but different barrel shapes
  6. 383563Protein Hypothetical protein MTH11 [101748] (1 species)
  7. 383564Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [101749] (1 PDB entry)
  8. 383565Domain d1oqka_: 1oqk A: [93419]

Details for d1oqka_

PDB Entry: 1oqk (more details)

PDB Description: structure of mth11: a homologue of human rnase p protein rpp29

SCOP Domain Sequences for d1oqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqka_ b.137.1.1 (A:) Hypothetical protein MTH11 {Archaeon Methanobacterium thermoautotrophicum}
rheliglsvriarsvhrdiqgisgrvvdetrntlriemddgreitvpkgiavfhfrtpqg
elveidgralvarpeeri

SCOP Domain Coordinates for d1oqka_:

Click to download the PDB-style file with coordinates for d1oqka_.
(The format of our PDB-style files is described here.)

Timeline for d1oqka_: