![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.217: SAND domain-like [63762] (1 superfamily) core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold |
![]() | Superfamily d.217.1: SAND domain-like [63763] (2 families) ![]() |
![]() | Family d.217.1.1: SAND domain [63764] (3 proteins) automatically mapped to Pfam PF01342 |
![]() | Protein Glucocorticoid modulatory element binding protein-1 (Gmeb1) [102845] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102846] (1 PDB entry) |
![]() | Domain d1oqjb_: 1oqj B: [93418] complexed with zn |
PDB Entry: 1oqj (more details), 1.55 Å
SCOPe Domain Sequences for d1oqjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqjb_ d.217.1.1 (B:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens) [TaxId: 9606]} dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai rlggimlrkmmdsgqidfyqhdkvcsntc
Timeline for d1oqjb_: