Lineage for d1oqjb_ (1oqj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006848Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 3006849Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 3006850Family d.217.1.1: SAND domain [63764] (3 proteins)
    automatically mapped to Pfam PF01342
  6. 3006851Protein Glucocorticoid modulatory element binding protein-1 (Gmeb1) [102845] (1 species)
  7. 3006852Species Human (Homo sapiens) [TaxId:9606] [102846] (1 PDB entry)
  8. 3006854Domain d1oqjb_: 1oqj B: [93418]
    complexed with zn

Details for d1oqjb_

PDB Entry: 1oqj (more details), 1.55 Å

PDB Description: crystal structure of the sand domain from glucocorticoid modulatory element binding protein-1 (gmeb1)
PDB Compounds: (B:) Glucocorticoid Modulatory Element Binding protein-1

SCOPe Domain Sequences for d1oqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqjb_ d.217.1.1 (B:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens) [TaxId: 9606]}
dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai
rlggimlrkmmdsgqidfyqhdkvcsntc

SCOPe Domain Coordinates for d1oqjb_:

Click to download the PDB-style file with coordinates for d1oqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1oqjb_: