Lineage for d1oqja_ (1oqj A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516089Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 516090Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 516091Family d.217.1.1: SAND domain [63764] (3 proteins)
  6. 516092Protein Glucocorticoid modulatory element binding protein-1 (Gmeb1) [102845] (1 species)
  7. 516093Species Human (Homo sapiens) [TaxId:9606] [102846] (1 PDB entry)
  8. 516094Domain d1oqja_: 1oqj A: [93417]

Details for d1oqja_

PDB Entry: 1oqj (more details), 1.55 Å

PDB Description: crystal structure of the sand domain from glucocorticoid modulatory element binding protein-1 (gmeb1)

SCOP Domain Sequences for d1oqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqja_ d.217.1.1 (A:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens)}
dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai
rlggimlrkmmdsgqidfyqhdkvcsntcr

SCOP Domain Coordinates for d1oqja_:

Click to download the PDB-style file with coordinates for d1oqja_.
(The format of our PDB-style files is described here.)

Timeline for d1oqja_: