Lineage for d1oqfb_ (1oqf B:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) 
Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
forms a swapped dimer
Protein 2-methylisocitrate lyase [89499] (2 species) Species Escherichia coli [TaxId:562] [89500] (2 PDB entries) 
Domain d1oqfb_: 1oqf B: [93416]
Details for d1oqfb_
PDB Entry: 1oqf (more details), 1.93 Å
PDB Description: Crystal structure of the 2-methylisocitrate lyase
SCOP Domain Sequences for d1oqfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqfb_ c.1.12.7 (B:) 2-methylisocitrate lyase {Escherichia coli}
slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa
SCOP Domain Coordinates for d1oqfb_:
Click to download the PDB-style file with coordinates for d1oqfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oqfb_:
- d1oqfb_ first appeared in SCOP 1.67
- d1oqfb_ appears in SCOP 1.71
- d1oqfb_ appears in the current release, SCOPe 2.08
View in 3D
