Lineage for d1oqfb_ (1oqf B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476105Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
    forms a swapped dimer
  6. 476106Protein 2-methylisocitrate lyase [89499] (2 species)
  7. 476107Species Escherichia coli [TaxId:562] [89500] (2 PDB entries)
  8. 476111Domain d1oqfb_: 1oqf B: [93416]

Details for d1oqfb_

PDB Entry: 1oqf (more details), 1.93 Å

PDB Description: Crystal structure of the 2-methylisocitrate lyase

SCOP Domain Sequences for d1oqfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqfb_ c.1.12.7 (B:) 2-methylisocitrate lyase {Escherichia coli}
slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa

SCOP Domain Coordinates for d1oqfb_:

Click to download the PDB-style file with coordinates for d1oqfb_.
(The format of our PDB-style files is described here.)

Timeline for d1oqfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oqfa_