![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) ![]() |
![]() | Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein) |
![]() | Protein Hypothetical protein YesU [101647] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry) |
![]() | Domain d1oq1d_: 1oq1 D: [93411] structural genomics; MCSG target APC1120 complexed with acy, gol |
PDB Entry: 1oq1 (more details), 1.7 Å
SCOP Domain Sequences for d1oq1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oq1d_ b.29.1.17 (D:) Hypothetical protein YesU {Bacillus subtilis} snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr
Timeline for d1oq1d_: