SCOPe 2.06: Domain d1oq1c1: 1oq1 C:1-220

Lineage for d1oq1c1 (1oq1 C:1-220)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein)
   automatically mapped to Pfam PF09224

6. Protein Hypothetical protein YesU [101647] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry)

8. Domain d1oq1c1: 1oq1 C:1-220 [93410]
   Other proteins in same PDB: d1oq1a2, d1oq1c2, d1oq1d2
   structural genomics; MCSG target APC1120
   complexed with acy, gol

Details for d1oq1c1

PDB Entry: 1oq1, 1.7 Å

PDB Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis

PDB Compounds: (C:) Protein yesU

SCOPe Domain Sequences for d1oq1c1:

Sequence; same for both SEQRES and ATOM records:

>d1oq1c1 b.29.1.17 (C:1-220) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]}
mykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdgi
ivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrrk
yaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpile
wmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr

Timeline for d1oq1c1:

• d1oq1c1 first appeared in SCOP 1.67, called d1oq1c_
  
• d1oq1c1 was called d1oq1c_ in SCOPe 2.05
  
• d1oq1c1 appears in SCOPe 2.07
  
• d1oq1c1 appears in the current release, SCOPe 2.08