Lineage for d1oq1c_ (1oq1 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556746Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein)
  6. 556747Protein Hypothetical protein YesU [101647] (1 species)
  7. 556748Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry)
  8. 556751Domain d1oq1c_: 1oq1 C: [93410]

Details for d1oq1c_

PDB Entry: 1oq1 (more details), 1.7 Å

PDB Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis

SCOP Domain Sequences for d1oq1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq1c_ b.29.1.17 (C:) Hypothetical protein YesU {Bacillus subtilis}
amykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdg
iivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrr
kyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpil
ewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr

SCOP Domain Coordinates for d1oq1c_:

Click to download the PDB-style file with coordinates for d1oq1c_.
(The format of our PDB-style files is described here.)

Timeline for d1oq1c_: