Lineage for d1oq1b_ (1oq1 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390130Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein)
    automatically mapped to Pfam PF09224
  6. 2390131Protein Hypothetical protein YesU [101647] (1 species)
  7. 2390132Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry)
  8. 2390134Domain d1oq1b_: 1oq1 B: [93409]
    Other proteins in same PDB: d1oq1a2, d1oq1c2, d1oq1d2
    structural genomics; MCSG target APC1120
    complexed with acy, gol

Details for d1oq1b_

PDB Entry: 1oq1 (more details), 1.7 Å

PDB Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis
PDB Compounds: (B:) Protein yesU

SCOPe Domain Sequences for d1oq1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq1b_ b.29.1.17 (B:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]}
mykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdgi
ivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrrk
yaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpile
wmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr

SCOPe Domain Coordinates for d1oq1b_:

Click to download the PDB-style file with coordinates for d1oq1b_.
(The format of our PDB-style files is described here.)

Timeline for d1oq1b_: