Lineage for d1oq1a_ (1oq1 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460693Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein)
  6. 460694Protein Hypothetical protein YesU [101647] (1 species)
  7. 460695Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry)
  8. 460696Domain d1oq1a_: 1oq1 A: [93408]

Details for d1oq1a_

PDB Entry: 1oq1 (more details), 1.7 Å

PDB Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis

SCOP Domain Sequences for d1oq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis}
snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr

SCOP Domain Coordinates for d1oq1a_:

Click to download the PDB-style file with coordinates for d1oq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1oq1a_: