SCOP 1.67: Domain d1oq1a_: 1oq1 A:

Lineage for d1oq1a_ (1oq1 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein)

6. Protein Hypothetical protein YesU [101647] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry)

8. Domain d1oq1a_: 1oq1 A: [93408]

Details for d1oq1a_

PDB Entry: 1oq1, 1.7 Å

PDB Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis

SCOP Domain Sequences for d1oq1a_:

Sequence; same for both SEQRES and ATOM records:

>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis}
snamykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfp
dgiivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyf
rrkyaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglp
ilewmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr

Timeline for d1oq1a_:

• d1oq1a_ is new in SCOP 1.67
  
• d1oq1a_ appears in SCOP 1.69
  
• d1oq1a_ appears in the current release, SCOPe 2.08, called d1oq1a1