Lineage for d1oq1a1 (1oq1 A:1-220)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.17: Hypothetical protein YesU [101646] (1 protein)
    automatically mapped to Pfam PF09224
  6. Protein Hypothetical protein YesU [101647] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [101648] (1 PDB entry)
  8. Domain d1oq1a1: 1oq1 A:1-220 [93408]
    Other proteins in same PDB: d1oq1a2, d1oq1c2, d1oq1d2
    structural genomics; MCSG target APC1120
    complexed with acy, gol

Details for d1oq1a1

PDB Entry: 1oq1 (more details), 1.7 Å

PDB Description: Crystal Structure of Protein of Unknown Function with Galectin-like Fold from Bacillus subtilis
PDB Compounds: (A:) Protein yesU

SCOPe Domain Sequences for d1oq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oq1a1 b.29.1.17 (A:1-220) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]}
mykegaclyrnplrsksdvkdwrmegggqisfddhslhlshvqdeahfvfwcpetfpdgi
ivtwdfspieqpglcmlffaaagirgedlfdpslrkrtgtypeyhsgdinalhlsyfrrk
yaeerafrtcnlrksrgfhlaamgadplpspddadspyrmklikdkgyvhfsinglpile
wmddgstygpvltkgkigfrqmapmkavyrdfavhqavrr

SCOPe Domain Coordinates for d1oq1a1 are not available.

Timeline for d1oq1a1:

Domains from same chain:
(mouse over for more information)
d1oq1a2
Domains from other chains:
(mouse over for more information)
d1oq1b_, d1oq1c1, d1oq1c2, d1oq1d1, d1oq1d2