Lineage for d1opia_ (1opi A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412351Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 412490Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species)
  7. 412491Species Human (Homo sapiens) [TaxId:9606] [54937] (4 PDB entries)
  8. 412493Domain d1opia_: 1opi A: [93406]
    third RNA-binding domain; complexed with an N-terminal Sf1/Mbbp peptide, chain B

Details for d1opia_

PDB Entry: 1opi (more details)

PDB Description: solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide

SCOP Domain Sequences for d1opia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opia_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)}
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

SCOP Domain Coordinates for d1opia_:

Click to download the PDB-style file with coordinates for d1opia_.
(The format of our PDB-style files is described here.)

Timeline for d1opia_: