Lineage for d1opha_ (1oph A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949015Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 1949016Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 1949017Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 1949084Protein Antitrypsin, alpha-1 [56582] (1 species)
  7. 1949085Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)
  8. 1949087Domain d1opha_: 1oph A: [93404]
    Other proteins in same PDB: d1ophb_
    complexed with trypsinogen

Details for d1opha_

PDB Entry: 1oph (more details), 2.3 Å

PDB Description: non-covalent complex between alpha-1-pi-pittsburgh and s195a trypsin
PDB Compounds: (A:) Alpha-1-antitrypsin precursor

SCOPe Domain Sequences for d1opha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opha_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
hptfnkitpnlaefafslyrqlahqsnstnilfspvsiaaafamlslgakgdthdeileg
lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh
seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe
vkdteeedfhvdqvttvkvpmmkrlgmfniqhskklsswvllmkylgnataifflpdegk
lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls
gvteeaplklskavhkavltidekgteaagamfleaiprsippevkfnkpfvfliieqnt
kaplfmgrvvnptqk

SCOPe Domain Coordinates for d1opha_:

Click to download the PDB-style file with coordinates for d1opha_.
(The format of our PDB-style files is described here.)

Timeline for d1opha_: