SCOP 1.69: Domain d1opeb2: 1ope B:1-246

Lineage for d1opeb2 (1ope B:1-246)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families)

5. Family c.124.1.2: CoA transferase alpha subunit-like [74656] (3 proteins)
   parallel beta-sheet of 7 strands, order 4321567

6. Protein Succinate:CoA transferase, N-terminal domain [82464] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [82465] (5 PDB entries)

8. Domain d1opeb2: 1ope B:1-246 [93403]
   Other proteins in same PDB: d1opea1, d1opeb1

Details for d1opeb2

PDB Entry: 1ope, 2.5 Å

PDB Description: deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart

SCOP Domain Sequences for d1opeb2:

Sequence; same for both SEQRES and ATOM records:

>d1opeb2 c.124.1.2 (B:1-246) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa)}
tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvr

Timeline for d1opeb2:

• d1opeb2 first appeared in SCOP 1.67
  
• d1opeb2 appears in SCOP 1.71
  
• d1opeb2 appears in the current release, SCOPe 2.08