Lineage for d1op4a_ (1op4 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037271Protein N-cadherin (neural) [49315] (1 species)
  7. 2037272Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 2037282Domain d1op4a_: 1op4 A: [93397]
    prodomain

Details for d1op4a_

PDB Entry: 1op4 (more details)

PDB Description: solution structure of neural cadherin prodomain
PDB Compounds: (A:) Neural-cadherin

SCOPe Domain Sequences for d1op4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
easgeialcktgfpedvysavlpkdvhegqpllnvkfsncnrkrkvqyessepadfkvde
dgtvyavrsfpltaeqakfliyaqdketqekwqvavnlsreptlteepmkepheieeivf
prqlakhsgalqrqkr

SCOPe Domain Coordinates for d1op4a_:

Click to download the PDB-style file with coordinates for d1op4a_.
(The format of our PDB-style files is described here.)

Timeline for d1op4a_: