![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (3 families) ![]() |
![]() | Family b.1.6.1: Cadherin [49314] (3 proteins) |
![]() | Protein N-cadherin (neural) [49315] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries) |
![]() | Domain d1op4a_: 1op4 A: [93397] prodomain |
PDB Entry: 1op4 (more details)
SCOPe Domain Sequences for d1op4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} easgeialcktgfpedvysavlpkdvhegqpllnvkfsncnrkrkvqyessepadfkvde dgtvyavrsfpltaeqakfliyaqdketqekwqvavnlsreptlteepmkepheieeivf prqlakhsgalqrqkr
Timeline for d1op4a_: