Lineage for d1oozb2 (1ooz B:1-246)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713168Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 713169Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (7 families) (S)
  5. 713200Family c.124.1.2: CoA transferase alpha subunit-like [74656] (6 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 713235Protein Succinate:CoA transferase, N-terminal domain [82464] (1 species)
  7. 713236Species Pig (Sus scrofa) [TaxId:9823] [82465] (5 PDB entries)
  8. 713240Domain d1oozb2: 1ooz B:1-246 [93395]
    Other proteins in same PDB: d1ooza1, d1oozb1
    complexed with k; mutant

Details for d1oozb2

PDB Entry: 1ooz (more details), 2.1 Å

PDB Description: deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (B:) succinyl-coa:3-ketoacid-coenzyme a transferase

SCOP Domain Sequences for d1oozb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oozb2 c.124.1.2 (B:1-246) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvr

SCOP Domain Coordinates for d1oozb2:

Click to download the PDB-style file with coordinates for d1oozb2.
(The format of our PDB-style files is described here.)

Timeline for d1oozb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oozb1