Lineage for d1ooza1 (1ooz A:260-481)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849026Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 849027Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families) (S)
  5. 849117Family c.124.1.3: CoA transferase beta subunit-like [74657] (3 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 849136Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
  7. 849137Species Pig (Sus scrofa) [TaxId:9823] [82467] (7 PDB entries)
  8. 849140Domain d1ooza1: 1ooz A:260-481 [93392]
    Other proteins in same PDB: d1ooza2, d1oozb2

Details for d1ooza1

PDB Entry: 1ooz (more details), 2.1 Å

PDB Description: deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (A:) succinyl-coa:3-ketoacid-coenzyme a transferase

SCOP Domain Sequences for d1ooza1:

Sequence, based on SEQRES records: (download)

>d1ooza1 c.124.1.3 (A:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgk
lvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv
drkkgltlielwegltvddikkstgcdfavspklipmqqvtt

Sequence, based on observed residues (ATOM records): (download)

>d1ooza1 c.124.1.3 (A:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmvkgm
ggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdrkkg
ltlielwegltvddikkstgcdfavspklipmqqvtt

SCOP Domain Coordinates for d1ooza1:

Click to download the PDB-style file with coordinates for d1ooza1.
(The format of our PDB-style files is described here.)

Timeline for d1ooza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ooza2