Lineage for d1oowa_ (1oow A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553583Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 553803Protein Plastocyanin [49507] (14 species)
  7. 553849Species Spinach (Spinacia oleracea) [TaxId:3562] [49511] (2 PDB entries)
  8. 553851Domain d1oowa_: 1oow A: [93387]
    complexed with cu; mutant

Details for d1oowa_

PDB Entry: 1oow (more details), 2 Å

PDB Description: the crystal structure of the spinach plastocyanin double mutant g8d/l12e gives insight into its low reactivity towards photosystem 1 and cytochrome f

SCOP Domain Sequences for d1oowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oowa_ b.6.1.1 (A:) Plastocyanin {Spinach (Spinacia oleracea)}
vevllggddgseaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOP Domain Coordinates for d1oowa_:

Click to download the PDB-style file with coordinates for d1oowa_.
(The format of our PDB-style files is described here.)

Timeline for d1oowa_: