Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Hypothetical protein YFR024c [101679] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101680] (1 PDB entry) |
Domain d1oota_: 1oot A: [93386] structural genomics; C-terminal domain complexed with cl |
PDB Entry: 1oot (more details), 1.39 Å
SCOPe Domain Sequences for d1oota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv
Timeline for d1oota_: