SCOPe 2.05: Domain d1oota_: 1oot A:

Lineage for d1oota_ (1oot A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Hypothetical protein YFR024c [101679] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101680] (1 PDB entry)

8. Domain d1oota_: 1oot A: [93386]
   structural genomics; C-terminal domain
   complexed with cl

Details for d1oota_

PDB Entry: 1oot, 1.39 Å

PDB Description: Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution

PDB Compounds: (A:) Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region

SCOPe Domain Sequences for d1oota_:

Sequence; same for both SEQRES and ATOM records:

>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

Timeline for d1oota_:

• d1oota_ first appeared in SCOP 1.67
  
• d1oota_ appears in SCOPe 2.04
  
• d1oota_ appears in SCOPe 2.06
  
• d1oota_ appears in the current release, SCOPe 2.08