Lineage for d1oohb_ (1ooh B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1734834Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1734835Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1734848Protein Odorant binding protein LUSH [101190] (1 species)
  7. 1734849Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 1734851Domain d1oohb_: 1ooh B: [93384]
    complexed with 1bo, act

Details for d1oohb_

PDB Entry: 1ooh (more details), 1.25 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with butanol
PDB Compounds: (B:) odorant binding protein LUSH

SCOPe Domain Sequences for d1oohb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oohb_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
gqfmwp

SCOPe Domain Coordinates for d1oohb_:

Click to download the PDB-style file with coordinates for d1oohb_.
(The format of our PDB-style files is described here.)

Timeline for d1oohb_: