Lineage for d1oohb_ (1ooh B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 641396Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 641397Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 641411Protein Odorant binding protein LUSH [101190] (1 species)
  7. 641412Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (6 PDB entries)
  8. 641414Domain d1oohb_: 1ooh B: [93384]
    complexed with 1bo, act

Details for d1oohb_

PDB Entry: 1ooh (more details), 1.25 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with butanol
PDB Compounds: (B:) odorant binding protein LUSH

SCOP Domain Sequences for d1oohb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oohb_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
gqfmwp

SCOP Domain Coordinates for d1oohb_:

Click to download the PDB-style file with coordinates for d1oohb_.
(The format of our PDB-style files is described here.)

Timeline for d1oohb_: