Lineage for d1ooha_ (1ooh A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769304Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 769305Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 769320Protein Odorant binding protein LUSH [101190] (1 species)
  7. 769321Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (6 PDB entries)
  8. 769322Domain d1ooha_: 1ooh A: [93383]

Details for d1ooha_

PDB Entry: 1ooh (more details), 1.25 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with butanol
PDB Compounds: (A:) odorant binding protein LUSH

SCOP Domain Sequences for d1ooha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooha_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtv
nkkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenad
gqfmwp

SCOP Domain Coordinates for d1ooha_:

Click to download the PDB-style file with coordinates for d1ooha_.
(The format of our PDB-style files is described here.)

Timeline for d1ooha_: