SCOP 1.69: Domain d1oogb_: 1oog B:

Lineage for d1oogb_ (1oog B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (4 PDB entries)

8. Domain d1oogb_: 1oog B: [93382]

Details for d1oogb_

PDB Entry: 1oog, 1.45 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with propanol

SCOP Domain Sequences for d1oogb_:

Sequence; same for both SEQRES and ATOM records:

>d1oogb_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster)}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d1oogb_:

• d1oogb_ first appeared in SCOP 1.67
  
• d1oogb_ appears in SCOP 1.71
  
• d1oogb_ appears in the current release, SCOPe 2.08