Lineage for d1oofb_ (1oof B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1269819Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1269820Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1269833Protein Odorant binding protein LUSH [101190] (1 species)
  7. 1269834Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 1269842Domain d1oofb_: 1oof B: [93380]
    complexed with act, eoh

Details for d1oofb_

PDB Entry: 1oof (more details), 1.49 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with ethanol
PDB Compounds: (B:) odorant binding protein LUSH

SCOPe Domain Sequences for d1oofb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oofb_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOPe Domain Coordinates for d1oofb_:

Click to download the PDB-style file with coordinates for d1oofb_.
(The format of our PDB-style files is described here.)

Timeline for d1oofb_: