SCOPe 2.02: Domain d1oofa_: 1oof A:

Lineage for d1oofa_ (1oof A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d1oofa_: 1oof A: [93379]
   complexed with act, eoh

Details for d1oofa_

PDB Entry: 1oof, 1.49 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with ethanol

PDB Compounds: (A:) odorant binding protein LUSH

SCOPe Domain Sequences for d1oofa_:

Sequence; same for both SEQRES and ATOM records:

>d1oofa_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d1oofa_:

• d1oofa_ first appeared in SCOP 1.67
  
• d1oofa_ appears in SCOPe 2.01
  
• d1oofa_ appears in SCOPe 2.03
  
• d1oofa_ appears in the current release, SCOPe 2.08