Lineage for d1oofa_ (1oof A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355743Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 355744Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 355753Protein Odorant binding protein LUSH [101190] (1 species)
  7. 355754Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (4 PDB entries)
  8. 355759Domain d1oofa_: 1oof A: [93379]

Details for d1oofa_

PDB Entry: 1oof (more details), 1.49 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with ethanol

SCOP Domain Sequences for d1oofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oofa_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster)}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOP Domain Coordinates for d1oofa_:

Click to download the PDB-style file with coordinates for d1oofa_.
(The format of our PDB-style files is described here.)

Timeline for d1oofa_: