Lineage for d1oocb_ (1ooc B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809288Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809289Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 809290Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 809295Protein Pectate lyase [51128] (5 species)
  7. 809301Species Erwinia chrysanthemi, type A [TaxId:556] [75024] (4 PDB entries)
  8. 809308Domain d1oocb_: 1ooc B: [93378]
    mutant

Details for d1oocb_

PDB Entry: 1ooc (more details), 2.94 Å

PDB Description: mutations in the t1.5 loop of pectate lyase a
PDB Compounds: (B:) pectate lyase A

SCOP Domain Sequences for d1oocb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oocb_ b.80.1.1 (B:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]}
aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
l

SCOP Domain Coordinates for d1oocb_:

Click to download the PDB-style file with coordinates for d1oocb_.
(The format of our PDB-style files is described here.)

Timeline for d1oocb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ooca_