Lineage for d1onqc1 (1onq C:184-279)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654498Protein CD1, alpha-3 domain [88615] (3 species)
  7. 654499Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (3 PDB entries)
  8. 654502Domain d1onqc1: 1onq C:184-279 [93368]
    Other proteins in same PDB: d1onqa2, d1onqb_, d1onqc2, d1onqd_
    complexed with fuc, nag, slf

Details for d1onqc1

PDB Entry: 1onq (more details), 2.15 Å

PDB Description: Crystal Structure of CD1a in Complex with a Sulfatide
PDB Compounds: (C:) T-cell surface glycoprotein CD1a

SCOP Domain Sequences for d1onqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onqc1 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywhh

SCOP Domain Coordinates for d1onqc1:

Click to download the PDB-style file with coordinates for d1onqc1.
(The format of our PDB-style files is described here.)

Timeline for d1onqc1: