Lineage for d1onqc1 (1onq C:184-279)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452816Protein CD1, alpha-3 domain [88615] (3 species)
  7. 452817Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (1 PDB entry)
  8. 452819Domain d1onqc1: 1onq C:184-279 [93368]
    Other proteins in same PDB: d1onqa2, d1onqb_, d1onqc2, d1onqd_

Details for d1onqc1

PDB Entry: 1onq (more details), 2.15 Å

PDB Description: Crystal Structure of CD1a in Complex with a Sulfatide

SCOP Domain Sequences for d1onqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onqc1 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywhh

SCOP Domain Coordinates for d1onqc1:

Click to download the PDB-style file with coordinates for d1onqc1.
(The format of our PDB-style files is described here.)

Timeline for d1onqc1: