SCOPe 2.05: Domain d1onlb_: 1onl B:

Lineage for d1onlb_ (1onl B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Thermus thermophilus [TaxId:274] [102003] (1 PDB entry)

8. Domain d1onlb_: 1onl B: [93363]

Details for d1onlb_

PDB Entry: 1onl, 2.5 Å

PDB Description: Crystal structure of Thermus thermophilus HB8 H-protein of the glycine cleavage system

PDB Compounds: (B:) glycine cleavage system H protein

SCOPe Domain Sequences for d1onlb_:

Sequence; same for both SEQRES and ATOM records:

>d1onlb_ b.84.1.1 (B:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]}
dipkdrfytkthewalpegdtvlvgitdyaqdalgdvvyvelpevgrvvekgeavavves
vktasdiyapvageivevnlalektpelvnqdpygegwifrlkprdmgdldelldaggyq
evlesea

Timeline for d1onlb_:

• d1onlb_ first appeared in SCOP 1.67
  
• d1onlb_ appears in SCOPe 2.04
  
• d1onlb_ appears in SCOPe 2.06
  
• d1onlb_ appears in the current release, SCOPe 2.08