Class b: All beta proteins [48724] (144 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) |
Family b.42.2.1: Ricin B-like [50371] (6 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species European mistletoe (Viscum album) [TaxId:3972] [50375] (9 PDB entries) different sequence variants |
Domain d1onkb2: 1onk B:138-263 [93361] Other proteins in same PDB: d1onka_ |
PDB Entry: 1onk (more details), 2.1 Å
SCOP Domain Sequences for d1onkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onkb2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)} taprevtiygfrdlcmesnggsvwvetcdssqknqkwalygdgsirpkqnqdqcltsgrd svstvinivscsgasgsqrwvftnegailnlknglamdvaqanpklrriiiypatgkpnq mwlpvf
Timeline for d1onkb2: