Lineage for d1onka_ (1onk A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420925Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 420926Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 420927Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 420989Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 420990Species European mistletoe (Viscum album) [TaxId:3972] [56382] (5 PDB entries)
    different sequence variants
  8. 420992Domain d1onka_: 1onk A: [93359]
    Other proteins in same PDB: d1onkb1, d1onkb2
    complexed with azi, gol, nag, po4

Details for d1onka_

PDB Entry: 1onk (more details), 2.1 Å

PDB Description: mistletoe lectin i from viscum album

SCOP Domain Sequences for d1onka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onka_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)}
yerlrlrvthqttgeeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
qgqdsvtaaidvtnayvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwryrqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
aimlfvcge

SCOP Domain Coordinates for d1onka_:

Click to download the PDB-style file with coordinates for d1onka_.
(The format of our PDB-style files is described here.)

Timeline for d1onka_: