![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
![]() | Protein beta-Lactamase, class A [56606] (16 species) |
![]() | Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (27 PDB entries) inhibited by tazobactam Uniprot Q5PSW7 ! Uniprot P14557 22-286 |
![]() | Domain d1onga_: 1ong A: [93356] complexed with ma4, wy4 |
PDB Entry: 1ong (more details), 1.1 Å
SCOPe Domain Sequences for d1onga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onga_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]} spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd tpasmaernqqiagigaaliehwqr
Timeline for d1onga_: