Lineage for d1omva_ (1omv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324265Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 2324266Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 2324272Domain d1omva_: 1omv A: [93353]
    complexed with ca; mutant

Details for d1omva_

PDB Entry: 1omv (more details), 1.9 Å

PDB Description: non-myristoylated bovine recoverin (e85q mutant) with calcium bound to ef-hand 3
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d1omva_:

Sequence, based on SEQRES records: (download)

>d1omva_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkaya
qhvfrsfdansdgtldfkqyvialhmtsagktnqklewafslydvdgngtisknevleiv
taifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrli
qfepqkvkekl

Sequence, based on observed residues (ATOM records): (download)

>d1omva_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkaya
qhvfrsfddgtldfkqyvialhmtsagktnqklewafslydvdgngtisknevleivtai
fkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqfe
pqkvkekl

SCOPe Domain Coordinates for d1omva_:

Click to download the PDB-style file with coordinates for d1omva_.
(The format of our PDB-style files is described here.)

Timeline for d1omva_: