SCOPe 2.06: Domain d1omva_: 1omv A:

Lineage for d1omva_ (1omv A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Recoverin [47533] (1 species)
   Calcium-myristoyl switch; only one EF-hand is functional

7. Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)

8. Domain d1omva_: 1omv A: [93353]
   complexed with ca; mutant

Details for d1omva_

PDB Entry: 1omv, 1.9 Å

PDB Description: non-myristoylated bovine recoverin (e85q mutant) with calcium bound to ef-hand 3

PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d1omva_:

Sequence, based on SEQRES records:

>d1omva_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkaya
qhvfrsfdansdgtldfkqyvialhmtsagktnqklewafslydvdgngtisknevleiv
taifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrli
qfepqkvkekl

Sequence, based on observed residues (ATOM records):

>d1omva_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkaya
qhvfrsfddgtldfkqyvialhmtsagktnqklewafslydvdgngtisknevleivtai
fkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqfe
pqkvkekl

Timeline for d1omva_:

• d1omva_ first appeared in SCOP 1.67
  
• d1omva_ appears in SCOPe 2.05
  
• d1omva_ appears in SCOPe 2.07
  
• d1omva_ appears in the current release, SCOPe 2.08