Lineage for d1omra_ (1omr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997291Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 1997292Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 1997294Domain d1omra_: 1omr A: [93349]
    complexed with ca

Details for d1omra_

PDB Entry: 1omr (more details), 1.5 Å

PDB Description: non-myristoylated wild-type bovine recoverin with calcium bound to EF-hand 3
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d1omra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
ilrliqfepqkvkeklkekkl

SCOPe Domain Coordinates for d1omra_:

Click to download the PDB-style file with coordinates for d1omra_.
(The format of our PDB-style files is described here.)

Timeline for d1omra_: