Lineage for d1omha_ (1omh A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415324Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 415325Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 415366Family d.89.1.5: Relaxase domain [103120] (2 proteins)
    circular permutation of the common fold
  6. 415372Protein TrwC relaxase [103123] (1 species)
  7. 415373Species Escherichia coli [TaxId:562] [103124] (3 PDB entries)
  8. 415374Domain d1omha_: 1omh A: [93348]
    complexed with so4

Details for d1omha_

PDB Entry: 1omh (more details), 1.95 Å

PDB Description: conjugative relaxase trwc in complex with orit dna. metal-free structure.

SCOP Domain Sequences for d1omha_:

Sequence, based on SEQRES records: (download)

>d1omha_ d.89.1.5 (A:) TrwC relaxase {Escherichia coli}
mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs

Sequence, based on observed residues (ATOM records): (download)

>d1omha_ d.89.1.5 (A:) TrwC relaxase {Escherichia coli}
mlshmvltrqdigraasyygdasewqgkgaeelglsgevdskrfrellagnigeghrimr
satrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaearaqarqki
qgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndeivkatry
lgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaargldpn
svsleqkqaakvlsrakktsvdrealraewqatakelgidfs

SCOP Domain Coordinates for d1omha_:

Click to download the PDB-style file with coordinates for d1omha_.
(The format of our PDB-style files is described here.)

Timeline for d1omha_: