SCOPe 2.01: Domain d1olzb1: 1olz B:537-628

Lineage for d1olzb1 (1olz B:537-628)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Semaphorin 4d Ig-like domain [101515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101516] (1 PDB entry)

8. Domain d1olzb1: 1olz B:537-628 [93344]
   Other proteins in same PDB: d1olza2, d1olza3, d1olzb2, d1olzb3

Details for d1olzb1

PDB Entry: 1olz, 2 Å

PDB Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d

PDB Compounds: (B:) semaphorin 4d

SCOPe Domain Sequences for d1olzb1:

Sequence; same for both SEQRES and ATOM records:

>d1olzb1 b.1.1.4 (B:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]}
kgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlseg
dsgvyqclseervknktvfqvvakhvlevkvv

Timeline for d1olzb1:

• d1olzb1 first appeared in SCOP 1.67
  
• d1olzb1 appears in SCOP 1.75
  
• d1olzb1 appears in SCOPe 2.02
  
• d1olzb1 appears in the current release, SCOPe 2.08