Lineage for d1olza3 (1olz A:481-536)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703340Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 1703369Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 1703370Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 1703381Protein Semaphorin 4d [103577] (1 species)
  7. 1703382Species Human (Homo sapiens) [TaxId:9606] [103578] (2 PDB entries)
  8. 1703383Domain d1olza3: 1olz A:481-536 [93343]
    Other proteins in same PDB: d1olza1, d1olza2, d1olzb1, d1olzb2

Details for d1olza3

PDB Entry: 1olz (more details), 2 Å

PDB Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d
PDB Compounds: (A:) semaphorin 4d

SCOPe Domain Sequences for d1olza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olza3 g.16.2.1 (A:481-536) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}
fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdks

SCOPe Domain Coordinates for d1olza3:

Click to download the PDB-style file with coordinates for d1olza3.
(The format of our PDB-style files is described here.)

Timeline for d1olza3: