![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
![]() | Superfamily g.16.2: Plexin repeat [103575] (1 family) ![]() |
![]() | Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
![]() | Protein Semaphorin 4d [103577] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103578] (2 PDB entries) |
![]() | Domain d1olza3: 1olz A:481-536 [93343] Other proteins in same PDB: d1olza1, d1olza2, d1olzb1, d1olzb2 |
PDB Entry: 1olz (more details), 2 Å
SCOPe Domain Sequences for d1olza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1olza3 g.16.2.1 (A:481-536) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpdks
Timeline for d1olza3: