Lineage for d1olza2 (1olz A:3-480)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066460Superfamily b.69.12: Sema domain [101912] (1 family) (S)
    irregular 7-bladed beta-propeller with a large insertion in the fifth blade
    automatically mapped to Pfam PF01403
  5. 2066461Family b.69.12.1: Sema domain [101913] (3 protein domains)
    Pfam PF01403
  6. 2066469Protein Semaphorin 4d [101914] (1 species)
  7. 2066470Species Human (Homo sapiens) [TaxId:9606] [101915] (2 PDB entries)
  8. 2066471Domain d1olza2: 1olz A:3-480 [93342]
    Other proteins in same PDB: d1olza1, d1olza3, d1olzb1, d1olzb3

Details for d1olza2

PDB Entry: 1olz (more details), 2 Å

PDB Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d
PDB Compounds: (A:) semaphorin 4d

SCOPe Domain Sequences for d1olza2:

Sequence, based on SEQRES records: (download)

>d1olza2 b.69.12.1 (A:3-480) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}
fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
pwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdqgg
lrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvgls
avcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytss
lnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvst
drgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla

Sequence, based on observed residues (ATOM records): (download)

>d1olza2 b.69.12.1 (A:3-480) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}
fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
pwlnepsfvfadvirkspgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtl
qkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavca
ynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlp
dktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrga
lhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla

SCOPe Domain Coordinates for d1olza2:

Click to download the PDB-style file with coordinates for d1olza2.
(The format of our PDB-style files is described here.)

Timeline for d1olza2: