Lineage for d1olza1 (1olz A:537-628)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295698Protein Semaphorin 4d Ig-like domain [101515] (1 species)
  7. 1295699Species Human (Homo sapiens) [TaxId:9606] [101516] (2 PDB entries)
  8. 1295700Domain d1olza1: 1olz A:537-628 [93341]
    Other proteins in same PDB: d1olza2, d1olza3, d1olzb2, d1olzb3

Details for d1olza1

PDB Entry: 1olz (more details), 2 Å

PDB Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d
PDB Compounds: (A:) semaphorin 4d

SCOPe Domain Sequences for d1olza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]}
kgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlseg
dsgvyqclseervknktvfqvvakhvlevkvv

SCOPe Domain Coordinates for d1olza1:

Click to download the PDB-style file with coordinates for d1olza1.
(The format of our PDB-style files is described here.)

Timeline for d1olza1: