Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Semaphorin 4d Ig-like domain [101515] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101516] (1 PDB entry) |
Domain d1olza1: 1olz A:537-628 [93341] Other proteins in same PDB: d1olza2, d1olza3, d1olzb2, d1olzb3 |
PDB Entry: 1olz (more details), 2 Å
SCOPe Domain Sequences for d1olza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} kgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlseg dsgvyqclseervknktvfqvvakhvlevkvv
Timeline for d1olza1: