SCOP 1.67: Domain d1olza1: 1olz A:537-628

Lineage for d1olza1 (1olz A:537-628)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Semaphorin 4d Ig-like domain [101515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101516] (1 PDB entry)

8. Domain d1olza1: 1olz A:537-628 [93341]
   Other proteins in same PDB: d1olza2, d1olza3, d1olzb2, d1olzb3

Details for d1olza1

PDB Entry: 1olz, 2 Å

PDB Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d

SCOP Domain Sequences for d1olza1:

Sequence; same for both SEQRES and ATOM records:

>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens)}
kgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlseg
dsgvyqclseervknktvfqvvakhvlevkvv

Timeline for d1olza1:

• d1olza1 is new in SCOP 1.67
  
• d1olza1 appears in SCOP 1.69
  
• d1olza1 appears in the current release, SCOPe 2.08