Lineage for d1olza1 (1olz A:537-628)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 366356Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 366610Protein Semaphorin 4d Ig-like domain [101515] (1 species)
  7. 366611Species Human (Homo sapiens) [TaxId:9606] [101516] (1 PDB entry)
  8. 366612Domain d1olza1: 1olz A:537-628 [93341]
    Other proteins in same PDB: d1olza2, d1olza3, d1olzb2, d1olzb3

Details for d1olza1

PDB Entry: 1olz (more details), 2 Å

PDB Description: the ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d

SCOP Domain Sequences for d1olza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens)}
kgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlseg
dsgvyqclseervknktvfqvvakhvlevkvv

SCOP Domain Coordinates for d1olza1:

Click to download the PDB-style file with coordinates for d1olza1.
(The format of our PDB-style files is described here.)

Timeline for d1olza1: