SCOPe 2.08: Domain d1olxb2: 1olx B:205-342

Lineage for d1olxb2 (1olx B:205-342)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
   automatically mapped to Pfam PF02780

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries)
   Uniprot P21953 52-392

8. Domain d1olxb2: 1olx B:205-342 [93340]
   Other proteins in same PDB: d1olxa_, d1olxb1
   complexed with gol, k, mn, tdp

Details for d1olxb2

PDB Entry: 1olx, 2.25 Å

PDB Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase

PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d1olxb2:

Sequence; same for both SEQRES and ATOM records:

>d1olxb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

Timeline for d1olxb2:

• d1olxb2 first appeared in SCOP 1.67
  
• d1olxb2 appears in SCOPe 2.07