![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88743] (8 PDB entries) |
![]() | Domain d1olxb1: 1olx B:2-204 [93339] Other proteins in same PDB: d1olxa_, d1olxb2 |
PDB Entry: 1olx (more details), 2.25 Å
SCOP Domain Sequences for d1olxb1:
Sequence, based on SEQRES records: (download)
>d1olxb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens)} ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs gdlfncgsltirspwgcvghgalyasqspeaffahcpgikvviprspfqakglllscied knpciffepkilyraaaeevpie
>d1olxb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens)} ahftfqeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkd rvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfnc gsltirspwgcvghgalyasqspeaffahcpgikvviprspfqakglllsciedknpcif fepkilyraaaeevpie
Timeline for d1olxb1: