Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) |
Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52928] (14 PDB entries) |
Domain d1olub2: 1olu B:205-342 [93337] Other proteins in same PDB: d1olua_, d1olub1 complexed with gol, k, mg, tdp; mutant |
PDB Entry: 1olu (more details), 1.9 Å
SCOP Domain Sequences for d1olub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1olub2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)} pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf yipdkwkcydalrkminy
Timeline for d1olub2: